Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEA9B Peptide - N-terminal region

MAGEA9B Peptide - N-terminal region

Product Specifications

Product Name Alternative

MAGEA9B

UniProt

P43362

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAGEA9B Rabbit Polyclonal Antibody (orb327176) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005278251

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PHCKPDEDLEAQGEDLGLMGAQEPTGEEEETTSSSDSKEEEVSAAGSSSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PREPL Antibody
RC-5873-01 50 μL

Recombinant PREPL Antibody

Sign In for Pricing
View Details
Recombinant PREPL Antibody
RC-5873-02 100 µL

Recombinant PREPL Antibody

Sign In for Pricing
View Details
Recombinant PREPL Antibody
RC-5873-03 1 mL

Recombinant PREPL Antibody

Sign In for Pricing
View Details
HindIII, 2500U
RV1276 2500 U

HindIII, 2500U

Sign In for Pricing
View Details
PRELID3A Human Gene Knockout Kit (CRISPR)
KN417148 1 Kit

PRELID3A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Meclizine N’-Oxide
TRC-M202710-50MG 50 mg

Meclizine N’-Oxide

Sign In for Pricing
View Details