Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBPF3 Peptide - N-terminal region

NBPF3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NBPF3, L7

UniProt

Q9H094

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NBPF3 Rabbit Polyclonal Antibody (orb587843) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CDQVKKEDQEATSPRLSRELLDEKEPEVLQDSLDRFYSTPFEYLELPDLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken LIM/homeobox protein Lhx8 (LHX8) ELISA Kit
GTR10335916 96 Well

Chicken LIM/homeobox protein Lhx8 (LHX8) ELISA Kit

Sign In for Pricing
View Details
MOXD1 Adenovirus (Human)
30342051 1.0 mL

MOXD1 Adenovirus (Human)

Sign In for Pricing
View Details
8-Azabicyclo[3.2.1]octan-3-one hydrochloride
OR4717-01 5 g

8-Azabicyclo[3.2.1]octan-3-one hydrochloride

Sign In for Pricing
View Details
8-Azabicyclo[3.2.1]octan-3-one hydrochloride
OR4717-02 25 g

8-Azabicyclo[3.2.1]octan-3-one hydrochloride

Sign In for Pricing
View Details
CYPD (Cyclophilin-related Protein, Cyclophilin-40, CYP-40, 40kD Peptidyl-prolyl Cis-trans Isomerase, Rotamase D, Peptidyl-prolyl Cis-trans Isomerase D, PPIase D, CYP40, PPID, MGC33096)
MBS646536-01 0.1 mL

CYPD (Cyclophilin-related Protein, Cyclophilin-40, CYP-40, 40kD Peptidyl-prolyl Cis-trans Isomerase, Rotamase D, Peptidyl-prolyl Cis-trans Isomerase D, PPIase D, CYP40, PPID, MGC33096)

Sign In for Pricing
View Details
CYPD (Cyclophilin-related Protein, Cyclophilin-40, CYP-40, 40kD Peptidyl-prolyl Cis-trans Isomerase, Rotamase D, Peptidyl-prolyl Cis-trans Isomerase D, PPIase D, CYP40, PPID, MGC33096)
MBS646536-02 5x 0.1 mL

CYPD (Cyclophilin-related Protein, Cyclophilin-40, CYP-40, 40kD Peptidyl-prolyl Cis-trans Isomerase, Rotamase D, Peptidyl-prolyl Cis-trans Isomerase D, PPIase D, CYP40, PPID, MGC33096)

Sign In for Pricing
View Details