Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4F3 Peptide - C-terminal region

OR4F3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR4F29

UniProt

Q6IEY1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR4F3 Rabbit Polyclonal Antibody (orb327177) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005224

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTVNSGFICVGTFFILLISYVFILFTVWKHSSGGSSKALSTLSAHSTVVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Loratadine Impurity 92
RM-L182092-01 10 mg

Loratadine Impurity 92

Sign In for Pricing
View Details
Loratadine Impurity 92
RM-L182092-02 25 mg

Loratadine Impurity 92

Sign In for Pricing
View Details
Loratadine Impurity 92
RM-L182092-03 50 mg

Loratadine Impurity 92

Sign In for Pricing
View Details
Loratadine Impurity 92
RM-L182092-04 100 mg

Loratadine Impurity 92

Sign In for Pricing
View Details
Slc2a6 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3203902 1.0 µg DNA

Slc2a6 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
FGF13 Antibody
orb128057-01 25 µg

FGF13 Antibody

Sign In for Pricing
View Details