ZNF197 Peptide - middle region
ZNF197 Peptide - middle region
Product Specifications
Product Name Alternative
P18, VHLaK, ZNF20, ZNF166, ZKSCAN9, ZSCAN41, D3S1363E
UniProt
O14709
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF197 Rabbit Polyclonal Antibody (orb587854) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001020026.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PHKCNECGKSFCRLSHLIQHQRTHSGEKPYECEECGKSFSRSSHLAQHQR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AAP42412-100UG 100 µg
ANGPTL3 Peptide - N-terminal region (AAP42412)
Sign In for Pricing
View Details