Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC34 Peptide - N-terminal region

TTC34 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TTC34

UniProt

J3KQ58

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC34 Rabbit Polyclonal Antibody (orb327184) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALLSQLPDTGAPLEDKDTQGLLAVGEALIKIDSGQPHWHLLLADILMAQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL2L13 Antibody
DF2649-01 100 µL

BCL2L13 Antibody

Sign In for Pricing
View Details
BCL2L13 Antibody
DF2649-02 200 µL

BCL2L13 Antibody

Sign In for Pricing
View Details
HYAL1 (NM_033159) Human Tagged ORF Clone Lentiviral Particle
RC216129L4V 200 µL

HYAL1 (NM_033159) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Chlamydia Trachomatis ELISA Kit
MBS3802963-01 48 Well

Human Chlamydia Trachomatis ELISA Kit

Sign In for Pricing
View Details
Human Chlamydia Trachomatis ELISA Kit
MBS3802963-02 96 Well

Human Chlamydia Trachomatis ELISA Kit

Sign In for Pricing
View Details
Human Chlamydia Trachomatis ELISA Kit
MBS3802963-03 5x 96 Well

Human Chlamydia Trachomatis ELISA Kit

Sign In for Pricing
View Details