TTC34 Peptide - N-terminal region
TTC34 Peptide - N-terminal region
Product Specifications
Product Name Alternative
TTC34
UniProt
J3KQ58
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TTC34 Rabbit Polyclonal Antibody (orb327184) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ALLSQLPDTGAPLEDKDTQGLLAVGEALIKIDSGQPHWHLLLADILMAQG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
EKU12050 96 Tests
Human Double C2 Like Domains Beta (DOC2b) ELISA Kit
Sign In for Pricing
View Details 
MBS6212878-01 0.1 mL
NT5M (5'(3')-deoxyribonucleotidase, Mitochondrial, 5',3'-nucleotidase, Mitochondrial, Deoxy-5'-nucleotidase 2, dNT-2, DNT2, mdN) (MaxLight 550)
Sign In for Pricing
View Details MBS6212878-02 5x 0.1 mL
NT5M (5'(3')-deoxyribonucleotidase, Mitochondrial, 5',3'-nucleotidase, Mitochondrial, Deoxy-5'-nucleotidase 2, dNT-2, DNT2, mdN) (MaxLight 550)
Sign In for Pricing
View Details 