Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NECAB1 Peptide - N-terminal region

NECAB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NECAB1, EFCBP1

UniProt

Q8N987

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NECAB1 Rabbit Polyclonal Antibody (orb587928) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071746

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEDSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant C2orf69 Monoclonal Antibody
AN300748L-01 50 µL

Recombinant C2orf69 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant C2orf69 Monoclonal Antibody
AN300748L-02 100 µL

Recombinant C2orf69 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human G-patch domain and KOW motifs-containing protein (C-His)
BP2968-50ug 50 µg

Recombinant Human G-patch domain and KOW motifs-containing protein (C-His)

Sign In for Pricing
View Details
NCGC00138783 TFA
MBS5819813 Inquire

NCGC00138783 TFA

Sign In for Pricing
View Details
Recombinant Human AK1 Protein, His (Fc)-Avi-tagged
AK1-300H 50 µg

Recombinant Human AK1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Mouse D-tyrosyl-tRNA, DTD1 ELISA Kit
MBS9320420-01 48 Well

Mouse D-tyrosyl-tRNA, DTD1 ELISA Kit

Sign In for Pricing
View Details