Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NECAB1 Peptide - N-terminal region

NECAB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NECAB1, EFCBP1

UniProt

Q8N987

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NECAB1 Rabbit Polyclonal Antibody (orb587928) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071746

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEDSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human mLLT10 Protein
E30P2091 20 µg

Recombinant Human mLLT10 Protein

Sign In for Pricing
View Details
Recombinant Shewanella frigidimarina UPF0114 protein Sfri_3655 (Sfri_3655)
orb2930996-01 20 µg

Recombinant Shewanella frigidimarina UPF0114 protein Sfri_3655 (Sfri_3655)

Sign In for Pricing
View Details
Recombinant Shewanella frigidimarina UPF0114 protein Sfri_3655 (Sfri_3655)
orb2930996-02 100 µg

Recombinant Shewanella frigidimarina UPF0114 protein Sfri_3655 (Sfri_3655)

Sign In for Pricing
View Details
Human BARK1 (Beta Adrenergic Receptor Kinase -1)
MBS766142-01 48 Well

Human BARK1 (Beta Adrenergic Receptor Kinase -1)

Sign In for Pricing
View Details
Human BARK1 (Beta Adrenergic Receptor Kinase -1)
MBS766142-02 96 Well

Human BARK1 (Beta Adrenergic Receptor Kinase -1)

Sign In for Pricing
View Details
Human BARK1 (Beta Adrenergic Receptor Kinase -1)
MBS766142-03 5x 96 Well

Human BARK1 (Beta Adrenergic Receptor Kinase -1)

Sign In for Pricing
View Details