Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP3K7 Peptide - C-terminal region

MAP3K7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MAP3K7, TAK1

UniProt

O43318

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAP3K7 Rabbit Polyclonal Antibody (orb587930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5'-O-DMTr-2'-O-MOE-rG (iBu)
NS098-10 10 g

5'-O-DMTr-2'-O-MOE-rG (iBu)

Sign In for Pricing
View Details
Prostaglandin E2 (PG-E2) Bovine ELISA Kit
G2055 96 Tests

Prostaglandin E2 (PG-E2) Bovine ELISA Kit

Sign In for Pricing
View Details
CENPA Rabbit Polyclonal Antibody (Fluoro647)
orb3076936 100 µg

CENPA Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 1, Acidic (FGF1)
MBS2027421-01 0.1 mL

Polyclonal Antibody to Fibroblast Growth Factor 1, Acidic (FGF1)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 1, Acidic (FGF1)
MBS2027421-02 0.2 mL

Polyclonal Antibody to Fibroblast Growth Factor 1, Acidic (FGF1)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor 1, Acidic (FGF1)
MBS2027421-03 0.5 mL

Polyclonal Antibody to Fibroblast Growth Factor 1, Acidic (FGF1)

Sign In for Pricing
View Details