Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLASP2 Peptide - N-terminal region

CLASP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CLASP2

UniProt

E7ENG2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLASP2 Rabbit Polyclonal Antibody (orb587942) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLIQRTFISYYISYQNKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100 Calcium Binding Protein A13 (S100A13) (NM_005979) Human Tagged ORF Clone Lentiviral Particle
RC222165L1V 200 µL

S100 Calcium Binding Protein A13 (S100A13) (NM_005979) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Chaetomium globosum Plasma membrane fusion protein PRM1 (PRM1), partial
MBS7076690 Inquire

Recombinant Chaetomium globosum Plasma membrane fusion protein PRM1 (PRM1), partial

Sign In for Pricing
View Details
Human Neural Cadherin ELISA Kit
MBS762775-01 48 Well

Human Neural Cadherin ELISA Kit

Sign In for Pricing
View Details
Human Neural Cadherin ELISA Kit
MBS762775-02 96 Well

Human Neural Cadherin ELISA Kit

Sign In for Pricing
View Details
Human Neural Cadherin ELISA Kit
MBS762775-03 5x 96 Well

Human Neural Cadherin ELISA Kit

Sign In for Pricing
View Details
Human Neural Cadherin ELISA Kit
MBS762775-04 10x 96 Well

Human Neural Cadherin ELISA Kit

Sign In for Pricing
View Details