Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLASP2 Peptide - N-terminal region

CLASP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CLASP2

UniProt

E7ENG2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLASP2 Rabbit Polyclonal Antibody (orb587942) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLIQRTFISYYISYQNKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl CpG Binding Protein 2 (MECP2) Antibody
abx403987-01 100 µL

Methyl CpG Binding Protein 2 (MECP2) Antibody

Sign In for Pricing
View Details
Methyl CpG Binding Protein 2 (MECP2) Antibody
abx403987-02 200 µL

Methyl CpG Binding Protein 2 (MECP2) Antibody

Sign In for Pricing
View Details
Methyl CpG Binding Protein 2 (MECP2) Antibody
abx403987-03 1 mL

Methyl CpG Binding Protein 2 (MECP2) Antibody

Sign In for Pricing
View Details
PCTAIRE1 (CDK16) Human qPCR Template Standard (NM_006201)
HK205465 1 Kit

PCTAIRE1 (CDK16) Human qPCR Template Standard (NM_006201)

Sign In for Pricing
View Details
α Enolase Double Nickase Plasmid (h)
sc-400633-NIC 20 µg

α Enolase Double Nickase Plasmid (h)

Sign In for Pricing
View Details
ST6GALNAC5, CT (ST6GALNAC5, SIAT7E, Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5, GD1 alpha synthase, GalNAc alpha-2,6-sialyltransferase V, ST6GalNAc V, Sialyltransferase 7E) (MaxLight 550) discontinued
042355-ML550 100 µL

ST6GALNAC5, CT (ST6GALNAC5, SIAT7E, Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5, GD1 alpha synthase, GalNAc alpha-2,6-sialyltransferase V, ST6GalNAc V, Sialyltransferase 7E) (MaxLight 550) discontinued

Sign In for Pricing
View Details