Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE6D Peptide - N-terminal region

PDE6D Peptide - N-terminal region

Product Specifications

Product Name Alternative

PDE6D, PDED

UniProt

O43924

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE6D Rabbit Polyclonal Antibody (orb587972) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002592

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thimerosal
TRC-T344530-25G 25 g

Thimerosal

Sign In for Pricing
View Details
Nicastrin (NCSTN) (NM_015331) Human Recombinant Protein
TP312646M 100 µg

Nicastrin (NCSTN) (NM_015331) Human Recombinant Protein

Sign In for Pricing
View Details
APF LB Broth Luria
0174 500 mL

APF LB Broth Luria

Sign In for Pricing
View Details
CYP24A1 Rabbit Polyclonal Antibody
HA500196 100 µL

CYP24A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HDAC4 Polyclonal Antibody
E-AB-67932-01 60 µL

HDAC4 Polyclonal Antibody

Sign In for Pricing
View Details
HDAC4 Polyclonal Antibody
E-AB-67932-02 120 µL

HDAC4 Polyclonal Antibody

Sign In for Pricing
View Details