Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE6D Peptide - N-terminal region

PDE6D Peptide - N-terminal region

Product Specifications

Product Name Alternative

PDE6D, PDED

UniProt

O43924

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE6D Rabbit Polyclonal Antibody (orb587972) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002592

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CGS 21680C Sodium Salt
TRC-C291800-5MG 5 mg

CGS 21680C Sodium Salt

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS713468 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR561080 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
PICALM Human Gene Knockout Kit (CRISPR)
KN209057 1 Kit

PICALM Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504428 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Supt7l Mouse Gene Knockout Kit (CRISPR)
KN516994 1 Kit

Supt7l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details