FMNL3 Peptide - C-terminal region
FMNL3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FMNL3
UniProt
Q8N4Y7
Field of Research
Cardiovascular Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FMNL3 Rabbit Polyclonal Antibody (orb587990) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKQLAQEAKKLDAKTPSQRNKWQQQELIAELRRRQAKEHRPVYEGKDGTI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470158-500 1x 500 µL
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880270-100 1x 100 µL
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400054-500 1x 500 µL
HCG-beta (HCGb/54), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470873-100 1x 100 µL
P34 / cdk1 (CDK1/873), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details