Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFIP1 Peptide - N-terminal region

ARFIP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARFIP1

UniProt

P53367

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARFIP1 Rabbit Polyclonal Antibody (orb588014) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0090 Lentiviral Activation Particles (h)
sc-418313-LAC 200 µL

KIAA0090 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
CtBP1 Antibody [L14F23]
C19829-50uL 50 μL

CtBP1 Antibody [L14F23]

Sign In for Pricing
View Details
MATR3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2822508 1.0 µg DNA

MATR3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
OTTMUSG00000000682 shRNA (m) Lentiviral Particles
sc-151364-V 200 µL

OTTMUSG00000000682 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Mitofusin-2 (Mfn2, Mitofusin-2, Transmembrane GTPase MFN2) (MaxLight 490)
029540-ML490 100 µL

Mitofusin-2 (Mfn2, Mitofusin-2, Transmembrane GTPase MFN2) (MaxLight 490)

Sign In for Pricing
View Details
CleanSeq, Clean-up Kit, 50 preps
dcu50 1 Unit

CleanSeq, Clean-up Kit, 50 preps

Sign In for Pricing
View Details