Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFIP1 Peptide - N-terminal region

ARFIP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARFIP1

UniProt

P53367

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARFIP1 Rabbit Polyclonal Antibody (orb588014) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPAN1 CRISPR/Cas9 KO Plasmid (h)
sc-404815 20 µg

TSPAN1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Lrrc63 ORF Vector (Mouse) (pORF)
ORF049450 1.0 µg DNA

Lrrc63 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG (H&L) - AcalephFluor750
CSA4111-01 100 µL

Goat Anti-Rabbit IgG (H&L) - AcalephFluor750

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG (H&L) - AcalephFluor750
CSA4111-02 500 μL

Goat Anti-Rabbit IgG (H&L) - AcalephFluor750

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG (H&L) - AcalephFluor750
CSA4111-03 1 mL

Goat Anti-Rabbit IgG (H&L) - AcalephFluor750

Sign In for Pricing
View Details
Lentiviral human ZBED4 shRNA (UAS) - Lentiviral human ZBED4 shRNA (UAS, iRFP) (100)
GTR15322998 1 Vial

Lentiviral human ZBED4 shRNA (UAS) - Lentiviral human ZBED4 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details