Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSWIM9 Peptide - C-terminal region

ZSWIM9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C19orf68

UniProt

Q86XI8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZSWIM9 Rabbit Polyclonal Antibody (orb327222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GEKGRALQIRDWRGGRLENQKPRGLEGGVLRGSKLEKGHLRGPEIRDWRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Meter™ Phosphatidylserine Apoptosis Assay Kit *Deep Red Fluorescence Optimized for Flow Cytometry*
22832-AAT 100 Tests

Cell Meter™ Phosphatidylserine Apoptosis Assay Kit *Deep Red Fluorescence Optimized for Flow Cytometry*

Sign In for Pricing
View Details
Recombinant C22orf15 Antibody
RN-031-01 50 μL

Recombinant C22orf15 Antibody

Sign In for Pricing
View Details
Recombinant C22orf15 Antibody
RN-031-02 100 µL

Recombinant C22orf15 Antibody

Sign In for Pricing
View Details
Recombinant C22orf15 Antibody
RN-031-03 1 mL

Recombinant C22orf15 Antibody

Sign In for Pricing
View Details
ATP6V0C (NM_001694) Human Over-expression Lysate
LY419794 100 µg

ATP6V0C (NM_001694) Human Over-expression Lysate

Sign In for Pricing
View Details
dTAG-7
TRC-D710015-5MG 5 mg

dTAG-7

Sign In for Pricing
View Details