ZSWIM9 Peptide - C-terminal region
ZSWIM9 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C19orf68
UniProt
Q86XI8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZSWIM9 Rabbit Polyclonal Antibody (orb327222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GEKGRALQIRDWRGGRLENQKPRGLEGGVLRGSKLEKGHLRGPEIRDWRG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY430396 100 µg
TGIF (TGIF1) (NM_173207) Human Over-expression Lysate
Sign In for Pricing
View Details 
PKSM040349 100 µg
Recombinant Mouse Contactin 2/CNTN2 Protein (His Tag)
Sign In for Pricing
View Details ![RNF168 Recombinant Rabbit Monoclonal Antibody [PSH07-37]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea817c3/imageurl/ha722825.webp)
HA722825 100 µL
RNF168 Recombinant Rabbit Monoclonal Antibody [PSH07-37]
Sign In for Pricing
View Details