Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC13A5 Peptide - middle region

SLC13A5 Peptide - middle region

Product Specifications

Product Name Alternative

SLC13A5, NACT

UniProt

Q86YT5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC13A5 Rabbit Polyclonal Antibody (orb579068) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CKAMTLCICYAASIGGTATLTGTGPNVVLLGQMNELFPDSKDLVNFASWF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rdh13 (NM_175372) Mouse Tagged ORF Clone
MG204963 10 µg

Rdh13 (NM_175372) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human LGALS9B Protein, N-His
orb3060930-01 50 µg

Recombinant Human LGALS9B Protein, N-His

Sign In for Pricing
View Details
Recombinant Human LGALS9B Protein, N-His
orb3060930-02 100 µg

Recombinant Human LGALS9B Protein, N-His

Sign In for Pricing
View Details
Recombinant Human LGALS9B Protein, N-His
orb3060930-03 1 mg

Recombinant Human LGALS9B Protein, N-His

Sign In for Pricing
View Details
Sialidase 3 Polyclonal Antibody, HRP Conjugated
bs-17482R-HRP 100 µL

Sialidase 3 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
ACY1 Detection Antibody
OAOA21962-50UG 50 µg

ACY1 Detection Antibody

Sign In for Pricing
View Details