Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC13A5 Peptide - middle region

SLC13A5 Peptide - middle region

Product Specifications

Product Name Alternative

SLC13A5, NACT

UniProt

Q86YT5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC13A5 Rabbit Polyclonal Antibody (orb579068) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CKAMTLCICYAASIGGTATLTGTGPNVVLLGQMNELFPDSKDLVNFASWF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Protein AMBP, AMBP ELISA KIT
EA0035Ch-01 96 Well

Chicken Protein AMBP, AMBP ELISA KIT

Sign In for Pricing
View Details
Chicken Protein AMBP, AMBP ELISA KIT
EA0035Ch-02 5x 96 Tests

Chicken Protein AMBP, AMBP ELISA KIT

Sign In for Pricing
View Details
Chicken Protein AMBP, AMBP ELISA KIT
EA0035Ch-03 10x 96 Tests

Chicken Protein AMBP, AMBP ELISA KIT

Sign In for Pricing
View Details
CENP-F HDR Plasmid (h)
sc-402178-HDR 20 µg

CENP-F HDR Plasmid (h)

Sign In for Pricing
View Details
Lentiviral mouse Srpk3 shRNA (UAS) - Lentiviral mouse Srpk3 shRNA (UAS, RFP) (100)
GTR15175344 1 Vial

Lentiviral mouse Srpk3 shRNA (UAS) - Lentiviral mouse Srpk3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Heparan Sulfate Proteoglycan (Perlecan, HSPG) (MaxLight 550)
MBS6259540-01 0.1 mL

Heparan Sulfate Proteoglycan (Perlecan, HSPG) (MaxLight 550)

Sign In for Pricing
View Details