Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRLR Peptide - middle region

PRLR Peptide - middle region

Product Specifications

Product Name Alternative

PRLR

UniProt

P16471

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRLR Rabbit Polyclonal Antibody (orb579148) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM5 AAV Vector (Mouse) (CMV)
38642104 1 µg

RBM5 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
OLFR1262 Adenovirus (Mouse)
32721054 1.0 mL

OLFR1262 Adenovirus (Mouse)

Sign In for Pricing
View Details
Terminalia Chebula Extract
E3254-5mg 5 mg

Terminalia Chebula Extract

Sign In for Pricing
View Details
Rat Tryptophan 5-hydroxylase 2,TPH2 ELISA KIT
JOT-EK2304Ra-01 96 Well

Rat Tryptophan 5-hydroxylase 2,TPH2 ELISA KIT

Sign In for Pricing
View Details
Rat Tryptophan 5-hydroxylase 2,TPH2 ELISA KIT
JOT-EK2304Ra-02 48 Well

Rat Tryptophan 5-hydroxylase 2,TPH2 ELISA KIT

Sign In for Pricing
View Details
TMEM11 CRISPR Knock Out 293T Cell Line (Human)
46866141 1x 10^6 Cells / 1.0 mL

TMEM11 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details