Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRLR Peptide - middle region

PRLR Peptide - middle region

Product Specifications

Product Name Alternative

PRLR

UniProt

P16471

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRLR Rabbit Polyclonal Antibody (orb579148) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Rab3A Antibody (OTI1G3) [DyLight 350]
NBP2-73773UV 0.1 mL

Mouse Monoclonal Rab3A Antibody (OTI1G3) [DyLight 350]

Sign In for Pricing
View Details
MED22 Polyclonal Antibody
E44H08449 100 µL

MED22 Polyclonal Antibody

Sign In for Pricing
View Details
FLT4 Mouse Monoclonal Antibody [Clone 9G6]
E45M17539V-2 50 µL

FLT4 Mouse Monoclonal Antibody [Clone 9G6]

Sign In for Pricing
View Details
PYCR2 Antibody
orb1324040 100 µL

PYCR2 Antibody

Sign In for Pricing
View Details
CD279 (Programmed cell death-1, PD-1) (FITC)
MBS6492428-01 0.1 mL

CD279 (Programmed cell death-1, PD-1) (FITC)

Sign In for Pricing
View Details
CD279 (Programmed cell death-1, PD-1) (FITC)
MBS6492428-02 5x 0.1 mL

CD279 (Programmed cell death-1, PD-1) (FITC)

Sign In for Pricing
View Details