Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLPPR5 Peptide - N-terminal region

PLPPR5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PAP2, PRG5, LPPR5, PAP2D

UniProt

Q32ZL2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLPPR5 Rabbit Polyclonal Antibody (orb330390) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032394

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLLPAALTSSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cefotiam Dihydrochloride
TRC-C243005-250MG 250 mg

Cefotiam Dihydrochloride

Sign In for Pricing
View Details
MSH2 (DNA Mismatch Repair Marker) (MSH2/2622), CF405S conjugate, 0.1mg/mL
BNC042622-500 1x 500 µL

MSH2 (DNA Mismatch Repair Marker) (MSH2/2622), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Hic2 activation kit by CRISPRa
GA206250 1 Kit

Mouse Hic2 activation kit by CRISPRa

Sign In for Pricing
View Details
Adcy3 (C-term) Rabbit Polyclonal Antibody
AP32981PU-N 100 µL

Adcy3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF488A conjugate, 0.1mg/mL
BNC881975-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glubionate Calcium Hydrate
TRC-G412750-500MG 500 mg

Glubionate Calcium Hydrate

Sign In for Pricing
View Details