Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLPPR5 Peptide - N-terminal region

PLPPR5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PAP2, PRG5, LPPR5, PAP2D

UniProt

Q32ZL2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLPPR5 Rabbit Polyclonal Antibody (orb330390) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032394

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLLPAALTSSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), 1mg/mL
BNUM0160-50 1x 50 µL

CD20 (B9E9), 1mg/mL

Sign In for Pricing
View Details
6Alpha-Hydroxy-21-desacetyl Deflazacort
TRC-H935805-5MG 5 mg

6Alpha-Hydroxy-21-desacetyl Deflazacort

Sign In for Pricing
View Details
Melanoma Inhibitory Activity (MIA) (NM_006533) Human Over-expression Lysate
LY401957 100 µg

Melanoma Inhibitory Activity (MIA) (NM_006533) Human Over-expression Lysate

Sign In for Pricing
View Details
JNK3 (MAPK10) Human Knockdown Lysate
LY300369 100 µg

JNK3 (MAPK10) Human Knockdown Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS628530 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
GGA2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D2]
TA507282AM 100 µL

GGA2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D2]

Sign In for Pricing
View Details