Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUTM2F Peptide - C-terminal region

NUTM2F Peptide - C-terminal region

Product Specifications

Product Name Alternative

NUTM2F

UniProt

A6NIL2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUTM2F Rabbit Polyclonal Antibody (orb326973) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVVQEYVDIMEELLGSHPGDTGEPEGQREKGKVEQPQEEDGITSDPGLLS

More Discoveries

Explore Other Products

Browse additional items from our catalog

StuI Restriction Endonucleases
E2405-01 1000 U

StuI Restriction Endonucleases

Sign In for Pricing
View Details
Nfkb2 3'UTR GFP Stable Cell Line
TU263936 1.0 mL

Nfkb2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
2-Benzyl-2-azabicyclo[2.1.1]hexane-1-carbonitrile
NTA96154-01 50 mg

2-Benzyl-2-azabicyclo[2.1.1]hexane-1-carbonitrile

Sign In for Pricing
View Details
2-Benzyl-2-azabicyclo[2.1.1]hexane-1-carbonitrile
NTA96154-02 0.5 g

2-Benzyl-2-azabicyclo[2.1.1]hexane-1-carbonitrile

Sign In for Pricing
View Details
SLC25A46 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV696686 1.0 µg DNA

SLC25A46 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Idh3a (NM_053638) Rat Tagged ORF Clone Lentiviral Particle
RR213230L3V 200 µL

Idh3a (NM_053638) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details