NUTM2F Peptide - C-terminal region
NUTM2F Peptide - C-terminal region
Product Specifications
Product Name Alternative
NUTM2F
UniProt
A6NIL2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NUTM2F Rabbit Polyclonal Antibody (orb326973) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EVVQEYVDIMEELLGSHPGDTGEPEGQREKGKVEQPQEEDGITSDPGLLS
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6209986-01 0.1 mL
SERPINH1, ID (Serine/Cysteine Proteinase Inhibitor, Clade H, Member 1, CBP1, CBP2, RA-A47, gp46)r (MaxLight 550)
Sign In for Pricing
View Details 
MBS6209986-02 5x 0.1 mL
SERPINH1, ID (Serine/Cysteine Proteinase Inhibitor, Clade H, Member 1, CBP1, CBP2, RA-A47, gp46)r (MaxLight 550)
Sign In for Pricing
View Details 
