Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NNAT Peptide - middle region

NNAT Peptide - middle region

Product Specifications

Product Name Alternative

NNAT

UniProt

Q16517

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NNAT Rabbit Polyclonal Antibody (orb327185) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_859017

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea-pig C3a (Complement Component 3a) ValidElisa Kit
EK347463 96 Well

Guinea-pig C3a (Complement Component 3a) ValidElisa Kit

Sign In for Pricing
View Details
MAP3K9 Antibody : HRP (OAAF02346-HRP)
OAAF02346-100UG-HRP 100 µg

MAP3K9 Antibody : HRP (OAAF02346-HRP)

Sign In for Pricing
View Details
CASS4 Polyclonal Antibody
E44H10415 100 µL

CASS4 Polyclonal Antibody

Sign In for Pricing
View Details
Research Grade Anivovetmab
VK689016-01 100 µg

Research Grade Anivovetmab

Sign In for Pricing
View Details
Research Grade Anivovetmab
VK689016-02 1 mg

Research Grade Anivovetmab

Sign In for Pricing
View Details
C6orf153 293 Cell Lysate
405059 0.1 mg

C6orf153 293 Cell Lysate

Sign In for Pricing
View Details