Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NNAT Peptide - middle region

NNAT Peptide - middle region

Product Specifications

Product Name Alternative

NNAT

UniProt

Q16517

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NNAT Rabbit Polyclonal Antibody (orb327185) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_859017

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ILVBL Protein Lysate (Human) with C-Ha Tag
24923031 100 µg

ILVBL Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Actn1 Mouse shRNA Plasmid (Locus ID 109711)
TR512354 1 Kit

Actn1 Mouse shRNA Plasmid (Locus ID 109711)

Sign In for Pricing
View Details
PSKH1 (NM_006742) Human Tagged Lenti ORF Clone
RC208968L1 10 µg

PSKH1 (NM_006742) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human hsa-miR-6874-3p miRNA Antagomir
abx887659-01 10 nmol

Human hsa-miR-6874-3p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-6874-3p miRNA Antagomir
abx887659-02 20 nmol

Human hsa-miR-6874-3p miRNA Antagomir

Sign In for Pricing
View Details
KR198 Rabbit Polyclonal Antibody
MBS9513056-01 0.05 mL

KR198 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details