Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OAS1 Peptide - C-terminal region

OAS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OAS1, OIAS

UniProt

P00973

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OAS1 Rabbit Polyclonal Antibody (orb587912) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058132

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HB9/HLXB9/MNX1 Recombinant Rabbit Monoclonal Antibody [JE32-08]
HA721410 100 µL

HB9/HLXB9/MNX1 Recombinant Rabbit Monoclonal Antibody [JE32-08]

Sign In for Pricing
View Details
Frozen Tissue Sections, Cartilage
CS642158 5x 5 µm

Frozen Tissue Sections, Cartilage

Sign In for Pricing
View Details
BAP1 (BRCA1 Associated Protein 1) (BAP1/2432), CF647 conjugate, 0.1mg/mL
BNC472432-500 1x 500 µL

BAP1 (BRCA1 Associated Protein 1) (BAP1/2432), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS805057 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
PE Anti-Mouse TCRβ Antibody[H57-597]
E-AB-F1123D-01 50 Tests

PE Anti-Mouse TCRβ Antibody[H57-597]

Sign In for Pricing
View Details
PE Anti-Mouse TCRβ Antibody[H57-597]
E-AB-F1123D-02 100 Tests

PE Anti-Mouse TCRβ Antibody[H57-597]

Sign In for Pricing
View Details