ADH4 Peptide - N-terminal region
ADH4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ADH4
UniProt
P08319
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ADH4 Rabbit Polyclonal Antibody (orb587915) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KFCLSPLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Endothelium Mouse Monoclonal Antibody [Clone ID: EN4]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd353/imageurl/am32179pu-n.webp)
AM32179PU-N 1 mL
Endothelium Mouse Monoclonal Antibody [Clone ID: EN4]
Sign In for Pricing
View Details ![Cd4 Rat Monoclonal Antibody [Clone ID: CT-CD4]](https://cdn.genprice.uk/products/937/68dd18bc061270361e909247/imageurl/cl004apc.webp)
![Myosin (MYL4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H6]](https://cdn.genprice.uk/products/937/68dd1b7e061270361ea1d9ac/imageurl/ta807580bm.webp)
TA807580BM 100 µL
Myosin (MYL4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H6]
Sign In for Pricing
View Details 
