ADH4 Peptide - N-terminal region
ADH4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ADH4
UniProt
P08319
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ADH4 Rabbit Polyclonal Antibody (orb587915) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KFCLSPLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Homeo box C10 (HOXC10) Mouse Monoclonal Antibody [Clone ID: OTI1E10]](https://cdn.genprice.uk/products/937/68dd18ba061270361e90844c/imageurl/cf808890.webp)
CF808890 100 µg
Homeo box C10 (HOXC10) Mouse Monoclonal Antibody [Clone ID: OTI1E10]
Sign In for Pricing
View Details 
BNC472829-500 1x 500 µL
Golgi Complex (Marker for Human Cells) (GLG1/2829R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Phospho-AMPK alpha 2 (S345) Recombinant Rabbit Monoclonal Antibody [JJ08-19]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea8294b/imageurl/et1701-37.webp)
ET1701-37 100 µL
Phospho-AMPK alpha 2 (S345) Recombinant Rabbit Monoclonal Antibody [JJ08-19]
Sign In for Pricing
View Details 