EIF5 Peptide - N-terminal region
EIF5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
EIF5
UniProt
Q6IBU0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EIF5 Rabbit Polyclonal Antibody (orb587916) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9715392-01 48 Tests
Human MAP Kinase-Activated Protein Kinase 5 (MAPKAPK5) ELISA Kit
Sign In for Pricing
View Details MBS9715392-02 96 Tests
Human MAP Kinase-Activated Protein Kinase 5 (MAPKAPK5) ELISA Kit
Sign In for Pricing
View Details MBS9715392-03 5x 96 Tests
Human MAP Kinase-Activated Protein Kinase 5 (MAPKAPK5) ELISA Kit
Sign In for Pricing
View Details 
MBS9501162-01 1 Kit
Phospho-Synapsin1 (Ser62) Colorimetric Cell-Based ELISA Kit
Sign In for Pricing
View Details