Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5 Peptide - N-terminal region

EIF5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EIF5

UniProt

Q6IBU0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF5 Rabbit Polyclonal Antibody (orb587916) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A43 Recombinant Protein (Mouse)
RP172709 100 µg

SLC25A43 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (AP) discontinued
247065-AP 100 µL

HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (AP) discontinued

Sign In for Pricing
View Details
CASP7 Antibody
CSB-PA004552KA01HU-100ul 100 µL

CASP7 Antibody

Sign In for Pricing
View Details
Reagecon 0.2 NTU Non Ratio Turbidity Standard
CRS-0.2-100 100 mL

Reagecon 0.2 NTU Non Ratio Turbidity Standard

Sign In for Pricing
View Details
LARP4 Rabbit Polyclonal Antibody (FITC)
orb2124402 100 µL

LARP4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Rabbit Anti BMP4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC) 120ul
IRBAMLBMP4AP076120UL 120 µL

Rabbit Anti BMP4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC) 120ul

Sign In for Pricing
View Details