Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTAP Peptide - middle region

MTAP Peptide - middle region

Product Specifications

Product Name Alternative

MTAP, MSAP

UniProt

Q13126

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTAP Rabbit Polyclonal Antibody (orb587920) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Schizosaccharomyces pombe Heat shock protein homolog pss1 (pss1), partial
MBS1173393 Inquire

Recombinant Schizosaccharomyces pombe Heat shock protein homolog pss1 (pss1), partial

Sign In for Pricing
View Details
Bovine Prostaglandin G/H synthase 1, PTGS1 ELISA Kit
MBS9322702-01 48 Well

Bovine Prostaglandin G/H synthase 1, PTGS1 ELISA Kit

Sign In for Pricing
View Details
Bovine Prostaglandin G/H synthase 1, PTGS1 ELISA Kit
MBS9322702-02 96 Well

Bovine Prostaglandin G/H synthase 1, PTGS1 ELISA Kit

Sign In for Pricing
View Details
Bovine Prostaglandin G/H synthase 1, PTGS1 ELISA Kit
MBS9322702-03 5x 96 Well

Bovine Prostaglandin G/H synthase 1, PTGS1 ELISA Kit

Sign In for Pricing
View Details
Bovine Prostaglandin G/H synthase 1, PTGS1 ELISA Kit
MBS9322702-04 10x 96 Well

Bovine Prostaglandin G/H synthase 1, PTGS1 ELISA Kit

Sign In for Pricing
View Details
3-Acetoxy-3-methylpentane-1,5-dioic acid anhydride
258771-01 500 mg

3-Acetoxy-3-methylpentane-1,5-dioic acid anhydride

Sign In for Pricing
View Details