Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A11 Peptide - N-terminal region

S100A11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

S100A11, MLN70, S100C

UniProt

P31949

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with S100A11 Rabbit Polyclonal Antibody (orb587923) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005611

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken gamma-amylase (AMY) ELISA Kit
EIA07293Ch 1 Kit

Chicken gamma-amylase (AMY) ELISA Kit

Sign In for Pricing
View Details
HIV1 gp41 antibody
20-HG83 1 mg

HIV1 gp41 antibody

Sign In for Pricing
View Details
ST8SIA4 (NM_175052) Human Tagged ORF Clone
RC215497 10 µg

ST8SIA4 (NM_175052) Human Tagged ORF Clone

Sign In for Pricing
View Details
Snx5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4736406 1.0 µg DNA

Snx5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Klhdc9 3'UTR GFP Stable Cell Line
TU160627 1.0 mL

Klhdc9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TOMM34 (Translocase of Outer Membrane 34kD Subunit, Mitochondrial Import Receptor Subunit TOM34, hTom34, HTOM34P, URCC3) (FITC)
134608-FITC 100 µL

TOMM34 (Translocase of Outer Membrane 34kD Subunit, Mitochondrial Import Receptor Subunit TOM34, hTom34, HTOM34P, URCC3) (FITC)

Sign In for Pricing
View Details