Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A11 Peptide - N-terminal region

S100A11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

S100A11, MLN70, S100C

UniProt

P31949

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with S100A11 Rabbit Polyclonal Antibody (orb587923) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005611

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,3-Difluorobenzaldehyde
sc-230822 1 g

2,3-Difluorobenzaldehyde

Sign In for Pricing
View Details
Installation Kit for ECO 96/Prima Series/Wee Series of Thermal Cyclers
MBPCR089-10R 10 Reaction

Installation Kit for ECO 96/Prima Series/Wee Series of Thermal Cyclers

Sign In for Pricing
View Details
YKL-06-061 50mg
A18836-50 50 mg

YKL-06-061 50mg

Sign In for Pricing
View Details
DUS3L siRNA (Human)
CRJ1233-01 15 nmol

DUS3L siRNA (Human)

Sign In for Pricing
View Details
DUS3L siRNA (Human)
CRJ1233-02 30 nmol

DUS3L siRNA (Human)

Sign In for Pricing
View Details
LMTK1 Polyclonal Antibody
ABP59129-01 30 µL

LMTK1 Polyclonal Antibody

Sign In for Pricing
View Details