Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF3 Peptide - N-terminal region

KLF3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KLF3, BKLF

UniProt

P57682

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLF3 Rabbit Polyclonal Antibody (orb587939) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057615

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YSTPLPEKFFQTPEGLSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPKAP1 Antibody
CSB-PA857767ESR2HU-01 50 μL

MAPKAP1 Antibody

Sign In for Pricing
View Details
MAPKAP1 Antibody
CSB-PA857767ESR2HU-02 100 µL

MAPKAP1 Antibody

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Desmoglein 1 (DSG1)
MBS2046697-01 0.1 mL

HRP-Linked Polyclonal Antibody to Desmoglein 1 (DSG1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Desmoglein 1 (DSG1)
MBS2046697-02 0.2 mL

HRP-Linked Polyclonal Antibody to Desmoglein 1 (DSG1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Desmoglein 1 (DSG1)
MBS2046697-03 0.5 mL

HRP-Linked Polyclonal Antibody to Desmoglein 1 (DSG1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Desmoglein 1 (DSG1)
MBS2046697-04 1 mL

HRP-Linked Polyclonal Antibody to Desmoglein 1 (DSG1)

Sign In for Pricing
View Details