KLF3 Peptide - N-terminal region
KLF3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
KLF3, BKLF
UniProt
P57682
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KLF3 Rabbit Polyclonal Antibody (orb587939) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057615
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YSTPLPEKFFQTPEGLSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K7406602 1.0 µg DNA
Olr517 sgRNA CRISPR Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details 
MBS651505-01 1 mg
Resistomycin (Croceomycin, Geliomycin, Heliomycin, Itamycin, Antibiotic 11-98, Antibiotic A 3733A, Antibiotic X 340)
Sign In for Pricing
View Details MBS651505-02 5x 1 mg
Resistomycin (Croceomycin, Geliomycin, Heliomycin, Itamycin, Antibiotic 11-98, Antibiotic A 3733A, Antibiotic X 340)
Sign In for Pricing
View Details MBS6453875-01 0.2 mL
ACAP2 (Arf-GAP with coiled-coil, ANK Repeat and PH Domain-Containing Protein 2, Centaurin-beta-2, Cnt-b2, ACAP2, CENTB2, KIAA0041) (APC)
Sign In for Pricing
View Details