RPL24 Peptide - N-terminal region
RPL24 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RPL24
UniProt
P83731
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RPL24 Rabbit Polyclonal Antibody (orb327194) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000977
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY426838 100 µg
Mitofusin 2 (MFN2) (NM_001127660) Human Over-expression Lysate
Sign In for Pricing
View Details 
PKSH031549 100 µg
Recombinant Human ATL1/SPG3A/Atlastin-1 Protein (GST Tag)
Sign In for Pricing
View Details ![(3S,4E)-5-[2-Cyclopropyl-4-(4-fluorophenyl)-3-quinolinyl]-3-hydroxy-4-pentenoic acid Calcium](https://cdn.genprice.uk/products/572/3411456856277/imageurl/trc-c661150-10mg.webp)
TRC-C661150-10MG 10 mg
(3S,4E)-5-[2-Cyclopropyl-4-(4-fluorophenyl)-3-quinolinyl]-3-hydroxy-4-pentenoic acid Calcium
Sign In for Pricing
View Details