LSG1 Peptide - C-terminal region
LSG1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
LSG1
UniProt
Q9H089
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LSG1 Rabbit Polyclonal Antibody (orb587962) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060855
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VQAVMGYKPGSGVVTASTASSENGAGKPWKKHGNRNKKEKSRRLYKHLDM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC683496-100 1x 100 µL
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3496), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
HA725199 100 µL
Human MCP4/CCL13 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
TRC-H952275-2.5MG 2.5 mg
(3Beta,9Beta,10Alpha)-3-Hydroxy-pregna-5,7-dien-20-one
Sign In for Pricing
View Details