LSG1 Peptide - C-terminal region
LSG1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
LSG1
UniProt
Q9H089
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LSG1 Rabbit Polyclonal Antibody (orb587962) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060855
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VQAVMGYKPGSGVVTASTASSENGAGKPWKKHGNRNKKEKSRRLYKHLDM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PD1 (PDCD1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI13D4]](https://cdn.genprice.uk/products/937/68dd1b7f061270361ea1dcdc/imageurl/ta807866bm.webp)
TA807866BM 100 µL
PD1 (PDCD1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI13D4]
Sign In for Pricing
View Details 
TP316724 20 µg
HIF1 beta (ARNT) (NM_001668) Human Recombinant Protein
Sign In for Pricing
View Details 
BNC042363-100 1x 100 µL
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details