Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCAL1 Peptide - N-terminal region

SMARCAL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SMARCAL1, HARP

UniProt

Q9NZC9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SMARCAL1 Rabbit Polyclonal Antibody (orb331416) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005246689

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QNLSSSSNADQRPHDSHSFQAKGIWKKPEEMPTACPGHSPRSQMALTGIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Doxorubicin
C02104-25mg 25 mg

Doxorubicin

Sign In for Pricing
View Details
FTCD 293 Cell Lysate
407707 0.1 mg

FTCD 293 Cell Lysate

Sign In for Pricing
View Details
Mouse Monoclonal STAT5A Antibody (251610) [Janelia Fluor 549]
FAB21741I 0.1 mL

Mouse Monoclonal STAT5A Antibody (251610) [Janelia Fluor 549]

Sign In for Pricing
View Details
Rat Aquaporin-12A (AQP12A) ELISA Kit
GTR10348335 96 Well

Rat Aquaporin-12A (AQP12A) ELISA Kit

Sign In for Pricing
View Details
AChRα9 Polyclonal Antibody
ABP57447-01 30 µL

AChRα9 Polyclonal Antibody

Sign In for Pricing
View Details
AChRα9 Polyclonal Antibody
ABP57447-02 100 µL

AChRα9 Polyclonal Antibody

Sign In for Pricing
View Details