Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCAL1 Peptide - N-terminal region

SMARCAL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SMARCAL1, HARP

UniProt

Q9NZC9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SMARCAL1 Rabbit Polyclonal Antibody (orb331416) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005246689

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QNLSSSSNADQRPHDSHSFQAKGIWKKPEEMPTACPGHSPRSQMALTGIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIR1 CRISPRa sgRNA lentivector (set of three targets)(Human)
16196121 3x 1.0µg DNA

CIR1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
LRRC57 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV686539 1.0 µg DNA

LRRC57 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
FOXRED2 Human Over-expression Lysate
orb1344388 100 µg

FOXRED2 Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Buxus microphylla Photosystem I iron-sulfur center (psaC)
MBS1072511-01 0.02 mg (E-Coli)

Recombinant Buxus microphylla Photosystem I iron-sulfur center (psaC)

Sign In for Pricing
View Details
Recombinant Buxus microphylla Photosystem I iron-sulfur center (psaC)
MBS1072511-02 0.1 mg (E-Coli)

Recombinant Buxus microphylla Photosystem I iron-sulfur center (psaC)

Sign In for Pricing
View Details
Recombinant Buxus microphylla Photosystem I iron-sulfur center (psaC)
MBS1072511-03 0.02 mg (Yeast)

Recombinant Buxus microphylla Photosystem I iron-sulfur center (psaC)

Sign In for Pricing
View Details