Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDCA3 Peptide - C-terminal region

CDCA3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDCA3

UniProt

F8WDL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDCA3 Rabbit Polyclonal Antibody (orb587965) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKEEARQPTETPVASQSSDKPSRDPETPRSSASSVPDFEEAVPGTCGHSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEK3 (Serine/Threonine-Protein Kinase Nek3, Never In Mitosis A-Related Kinase 3, NimA-Related Protein Kinase 3, HSPK 36, MGC29949) (AP) discontinued
130277-AP 100 µL

NEK3 (Serine/Threonine-Protein Kinase Nek3, Never In Mitosis A-Related Kinase 3, NimA-Related Protein Kinase 3, HSPK 36, MGC29949) (AP) discontinued

Sign In for Pricing
View Details
MOCOS (NM_017947) Human Recombinant Protein
PH39981M5 20 µg

MOCOS (NM_017947) Human Recombinant Protein

Sign In for Pricing
View Details
Exnef Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
19556066 1.0 µg DNA

Exnef Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CYLC1 (Cylicin-1, Cylicin I, Multiple-band Polypeptide I, CYL, CYL1) APC
MBS6136134-01 0.1 mL

CYLC1 (Cylicin-1, Cylicin I, Multiple-band Polypeptide I, CYL, CYL1) APC

Sign In for Pricing
View Details
CYLC1 (Cylicin-1, Cylicin I, Multiple-band Polypeptide I, CYL, CYL1) APC
MBS6136134-02 5x 0.1 mL

CYLC1 (Cylicin-1, Cylicin I, Multiple-band Polypeptide I, CYL, CYL1) APC

Sign In for Pricing
View Details
Rat S100B (S100 Calcium Binding Protein B) ELISA Kit
EKE62264 96 Tests

Rat S100B (S100 Calcium Binding Protein B) ELISA Kit

Sign In for Pricing
View Details