Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDCA3 Peptide - C-terminal region

CDCA3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDCA3

UniProt

F8WDL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDCA3 Rabbit Polyclonal Antibody (orb587965) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKEEARQPTETPVASQSSDKPSRDPETPRSSASSVPDFEEAVPGTCGHSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCKDH kinase (BCKDK) Rabbit Polyclonal Antibody
TA365513 100 µL

BCKDH kinase (BCKDK) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LMNB1 Antibody
A16848-50UG 50 µg

LMNB1 Antibody

Sign In for Pricing
View Details
SLC6A17 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
44254154 3x 1.0 µg DNA

SLC6A17 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Camidanlumab ELISA Kit
abx395023 96 Tests

Camidanlumab ELISA Kit

Sign In for Pricing
View Details
Phospho-RSK1 p90 (Thr573) Recombinant Rabbit mAb
E43S43209 100 µL

Phospho-RSK1 p90 (Thr573) Recombinant Rabbit mAb

Sign In for Pricing
View Details
NVL Antibody (C-term)
orb1434641-01 50 µL

NVL Antibody (C-term)

Sign In for Pricing
View Details