Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SENP8 Peptide - middle region

SENP8 Peptide - middle region

Product Specifications

Product Name Alternative

SENP8, DEN1, NEDP1, PRSC2, FKSG8

UniProt

Q96LD8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SENP8 Rabbit Polyclonal Antibody (orb587981) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005254214

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Sperm Specific Antigen 2 ELISA Kit
MBS734234-01 48 Well

Monkey Sperm Specific Antigen 2 ELISA Kit

Sign In for Pricing
View Details
Monkey Sperm Specific Antigen 2 ELISA Kit
MBS734234-02 96 Well

Monkey Sperm Specific Antigen 2 ELISA Kit

Sign In for Pricing
View Details
Monkey Sperm Specific Antigen 2 ELISA Kit
MBS734234-03 5x 96 Well

Monkey Sperm Specific Antigen 2 ELISA Kit

Sign In for Pricing
View Details
Monkey Sperm Specific Antigen 2 ELISA Kit
MBS734234-04 10x 96 Well

Monkey Sperm Specific Antigen 2 ELISA Kit

Sign In for Pricing
View Details
Recombinant Mycoplasma Hyopneumoniae rpsH Protein (aa 1-131) (strain 232)
VAng-Lsx06628-50gEcoli 50 µg (E. coli)

Recombinant Mycoplasma Hyopneumoniae rpsH Protein (aa 1-131) (strain 232)

Sign In for Pricing
View Details
GIT2 (NM_139201) Human Over-expression Lysate
LS009815 100 µg

GIT2 (NM_139201) Human Over-expression Lysate

Sign In for Pricing
View Details