Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMOD2 Peptide - N-terminal region

TMOD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TMOD2, NTMOD

UniProt

Q9NZR1

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMOD2 Rabbit Polyclonal Antibody (orb587987) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POFUT1, CT (POFUT1, FUT12, KIAA0180, GDP-fucose protein O-fucosyltransferase 1, Peptide-O-fucosyltransferase 1) (APC) discontinued
040237-APC 200 µL

POFUT1, CT (POFUT1, FUT12, KIAA0180, GDP-fucose protein O-fucosyltransferase 1, Peptide-O-fucosyltransferase 1) (APC) discontinued

Sign In for Pricing
View Details
c-Fms Polyclonal Antibody
MBS8521863-01 0.1 mg

c-Fms Polyclonal Antibody

Sign In for Pricing
View Details
c-Fms Polyclonal Antibody
MBS8521863-02 0.1 mL (AF635)

c-Fms Polyclonal Antibody

Sign In for Pricing
View Details
c-Fms Polyclonal Antibody
MBS8521863-03 0.1 mL (AF610)

c-Fms Polyclonal Antibody

Sign In for Pricing
View Details
c-Fms Polyclonal Antibody
MBS8521863-04 0.1 mL (AF405S)

c-Fms Polyclonal Antibody

Sign In for Pricing
View Details
c-Fms Polyclonal Antibody
MBS8521863-05 0.1 mL (AF405L)

c-Fms Polyclonal Antibody

Sign In for Pricing
View Details