Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMOD2 Peptide - N-terminal region

TMOD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TMOD2, NTMOD

UniProt

Q9NZR1

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMOD2 Rabbit Polyclonal Antibody (orb587987) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-Nornicotyrine
TRC-N825000-10MG 10 mg

Beta-Nornicotyrine

Sign In for Pricing
View Details
Uridine-13C,15N2 2',3',5'-Tribenzoate
TRC-U830047-2.5MG 2.5 mg

Uridine-13C,15N2 2',3',5'-Tribenzoate

Sign In for Pricing
View Details
Recombinant Swine CXCL13 protein (His Tag)
PKSS000023-01 5 µg

Recombinant Swine CXCL13 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Swine CXCL13 protein (His Tag)
PKSS000023-02 20 µg

Recombinant Swine CXCL13 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD200R1 Protein (His Tag)
PKSH033375-01 10 µg

Recombinant Human CD200R1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD200R1 Protein (His Tag)
PKSH033375-02 50 µg

Recombinant Human CD200R1 Protein (His Tag)

Sign In for Pricing
View Details