Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC28A Peptide - C-terminal region

CCDC28A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCDC28A, C6orf80

UniProt

Q8IWP9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC28A Rabbit Polyclonal Antibody (orb588027) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EQMEHVRGMQEKLARLNLELYGELEELPEDKRKTASDSNLDRLLSDLEEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYTM Rabbit Polyclonal Antibody
BT-AP12931-01 20 µL

SYTM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SYTM Rabbit Polyclonal Antibody
BT-AP12931-02 50 µL

SYTM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SYTM Rabbit Polyclonal Antibody
BT-AP12931-03 100 µL

SYTM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phenylphosphinic acid
MBS5772470 Inquire

Phenylphosphinic acid

Sign In for Pricing
View Details
LTB4R2 sgRNA CRISPR Lentivector (Human) (Target 2)
K1243103 1.0 µg DNA

LTB4R2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse C-type lectin domain family 2 member L (CLEC2L) ELISA Kit
MBS7240114-01 48 Well

Mouse C-type lectin domain family 2 member L (CLEC2L) ELISA Kit

Sign In for Pricing
View Details