Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF6 Peptide - C-terminal region

DCAF6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NRIP, ARCAP, IQWD1, PC326, MSTP055, 1200006M05Rik

UniProt

Q58WW2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCAF6 Rabbit Polyclonal Antibody (orb327212) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017977.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMLEETRNTITVPASFMLRMLASLNHIRADRLEGDRSEGSGQENENEDEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Apc1 (ANAPC1) activation kit by CRISPRa
GA112103 1 Kit

Human Apc1 (ANAPC1) activation kit by CRISPRa

Sign In for Pricing
View Details
Human DPPA5 activation kit by CRISPRa
GA117463 1 Kit

Human DPPA5 activation kit by CRISPRa

Sign In for Pricing
View Details
APOE3 Human
OM296956-01 1 mg

APOE3 Human

Sign In for Pricing
View Details
APOE3 Human
OM296956-02 100 µg

APOE3 Human

Sign In for Pricing
View Details
APOE3 Human
OM296956-03 500 µg

APOE3 Human

Sign In for Pricing
View Details
Recombinant Human CCDC134 Protein (His Tag)
PKSH032266-01 10 µg

Recombinant Human CCDC134 Protein (His Tag)

Sign In for Pricing
View Details